PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G008800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 935aa    MW: 102327 Da    PI: 5.0183
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G008800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.2e-195096148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd +l +av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
  Sevir.5G008800.1.p 50 KGNWTPEEDSILSRAVQTYQGKNWKKIAECFP-DRTDVQCLHRWQKVL 96
                        79******************************.************986 PP

2Myb_DNA-binding62.11.1e-19102148148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g+W++eEde++v+ v+++G++ W+tIa+ ++ gR +kqc++rw+++l
  Sevir.5G008800.1.p 102 KGPWSKEEDEIIVQMVNKYGPKKWSTIAQALP-GRIGKQCRERWHNHL 148
                         79******************************.*************97 PP

3Myb_DNA-binding47.34.8e-15154196145
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         + +WT+eE+  l++a++++G++ W+   + ++ gRt++ +k++w+
  Sevir.5G008800.1.p 154 KEAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNAIKNHWN 196
                         579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2144596IPR017930Myb domain
SuperFamilySSF466898.28E-1948110IPR009057Homeodomain-like
SMARTSM007174.0E-174998IPR001005SANT/Myb domain
PfamPF002494.0E-165096IPR001005SANT/Myb domain
CDDcd001677.36E-155296No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2352107IPR009057Homeodomain-like
PROSITE profilePS5129431.9297152IPR017930Myb domain
SuperFamilySSF466892.26E-3199195IPR009057Homeodomain-like
SMARTSM007171.5E-18101150IPR001005SANT/Myb domain
CDDcd001672.72E-16104148No hitNo description
PfamPF139213.0E-18105165No hitNo description
Gene3DG3DSA:1.10.10.604.8E-27108151IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.1E-21152203IPR009057Homeodomain-like
PROSITE profilePS5129419.654153203IPR017930Myb domain
SMARTSM007174.4E-14153201IPR001005SANT/Myb domain
CDDcd001676.53E-11156196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 935 aa     Download sequence    Send to blast
MASDKAKVAK KGGEDPGLPP ASREGENSHE PQRQRSLNGR TTGPTRRSTK GNWTPEEDSI  60
LSRAVQTYQG KNWKKIAECF PDRTDVQCLH RWQKVLNPEL VKGPWSKEED EIIVQMVNKY  120
GPKKWSTIAQ ALPGRIGKQC RERWHNHLNP AINKEAWTQE EEITLIHAHR MYGNKWAELT  180
KFLPGRTDNA IKNHWNSSVK KKVDSYISSG LLSQVPCLPL IECPSQCNSL STMNLQNNGD  240
SGCNAQNTNL ALSCDLQENM DANKSEAQDS HSSMCQGTCY TSTEAVGSAL PDGHHHLSSS  300
FSQRLDLQMD VHEGSGNSMF VDEQTLCSTS NQENSMVPFG VAQEMPVSVL SSVSDAEQKL  360
HLISDADSLK SELWKDVSLQ TLISGDTVDA ASSGLNQLPD TSKTDTNFLA QPYPLHTSNP  420
SSVMETVYER STLVTVSSSF LCLDSLPGAP GNRSEPMDML DSEAEMITCS NNSFCDAEQS  480
AKPGSSDDRP GDFTMIENTT NCRSQQSTDA EEAVASTAKE QLPKDIETVP DEKKGEGALF  540
YEPPRFPGVD VPFISCDLVT SADLQEFSPL GIRQWMRSTM NVPTPLRLWG SPTHDESPDA  600
LKTAAESFPC TPSIMKKRHR GLLSPTPDKR IEKKSGIAKE MTDISYMITA TCSVNTTKDE  660
ATVTESLVCA EQSSFKHLDK KLEFSDGNKE NSDGAPEQAR DAQNAGNKQL VDEGGQRCSS  720
PNVANPNADL PDNSQPVGIL VEHEHNCNDL IATDHGAKPE SLSFCKEAVN SKSKPADLVV  780
EKSSPCINAD YEYVNLLADT PGVKRGLESP SAWKSPWYID MHMSFQGFVS PADRTYDALG  840
LVKQISKHSA AAAVEACEVL ASGSRPSDAE NKENTDDKEP GTRKSQTKIM AEARVLDFDE  900
YSTPARTADK RLSSCLGRSV SSPILSSPNL RSFR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-67502036159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-67502036159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0875061e-155BT087506.1 Zea mays full-length cDNA clone ZM_BFb0098J09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967414.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLK3XEN20.0K3XEN2_SETIT; Uncharacterized protein
STRINGSi000349m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-105Homeodomain-like protein